Молекулярное моделирование и структурно-динамические особенности эукариотических катионных каналов тема диссертации и автореферата по ВАК РФ 03.01.02, кандидат биологических наук Попинако, Анна Владимировна

• Попинако, Анна Владимировна
• кандидат биологических наук
• 2013

Оглавление диссертации кандидат биологических наук Попинако, Анна Владимировна

Оглавление

Список сокращений

Введение

Глава I. ОБЗОР ЛИТЕРАТУРЫ

1.1.Концепция ионных каналов

1.1.1.Общее строение ионных каналов

1.1.2.Принципы наименования и классификации каналов

1.1.3. Эволюция ионных каналов

1.2.Тетрамерные потенциал-зависимые калиевые каналы: особенности строения и функционирования

1.2.1. Структура и конформационные перестройки при активации ПЗ калиевых каналов

1.2.2. Каналы Kv2.1,Kv 10.2

1.3.Пентамерные лиганд-зависимые каналы: особенности строения и функционирования

1.3.1. Структура и конформационные перестройки при активации пентамерных J13 ионных каналов

1.3.2. Серотониновый 5-НТЗ рецептор

Глава II. МАТЕРИАЛЫ И МЕТОДЫ

2.1. Комплексный метод моделирования атомной структуры ионных каналов

2.1.1.Метод моделирования по гомологии

2.1.2. Фиттинг

2.2. Метод молекулярной динамики

2.2.¡.Физические основы метода МД

2.2.2 Валентные взаимодействия

2.2.3. Невалентные взаимодействия

2.2.4 Численное интегрирование

2.2.5 Поддержание постоянной температуры

2.2.6. Поддержание постоянного давления

2.2.7. Неравновесная молекулярная динамика

2.2.8. Понятие свободной энергии как потенциала средней силы. Метод Constraint force

2.3. Анализ закрытой и открытой структуры канала. Программа HOLE

ГЛАВА III. РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЯ И ИХ ОБСУЖДЕНИЕ

3.1. Моделирование структуры пентамерных и тетрамерных ионных каналов в открытой и закрытой конформациях

3.1.1. Моделирование структуры пентамерных и тетрамерных ионных каналов в открытой и закрытой конформациях

3.1.2. Оптимизация моделирования

3.1.3. Сравнительный анализ моделей ионных каналов с различной симметрией

3.1.4. Особенности строения моделей каналов Кл/

3.1.5. Особенности строения моделей 5-НТЗ рецептора

3.2. Структурные и динамические свойства тетрамерных ионных каналов в разных конформациях на примере канала Ку2. 1

3.3. Структурные и динамические свойства пентамерного ионного канала в разных конформациях на примере 5-НТЗ рецептора

3.4. Структурно-динамические особенности селективности катионных каналов с различной симметрией

3.5. Потенциал средней силы для канала Ку2.1 и серотонинового 5-НТЗ рецептора: анализ энергетических барьеров

Заключение

Выводы

Список литературы

Приложение 1

Приложение 2

Список сокращений

а.о. - аминокислотный остаток МД - молекулярная динамика ММ - молекулярное моделирование

МДГФ - метод гибкого фиттинга с использованием молекулярной динамики JI3 - лиганд-зависимые ПЗ - потенциал-зависимые

ПОФХ - пальмитоилолеоилфосфатидилхолиновые липиды

СФ - селективный фильтр

УМД - управляемая молекулярная динамика

ТМ - трансмембранный

ЭМ - электронная микроскопия

ЯМР - ядерно-магнитный резонанс

AChBP - ацетилхолин связывающий белок (acetylcholine binding protein)

cNBD - домен, связывающий циклические нуклеотиды (cyclic nucleotide-binding domain)

СТА - С-концевой активацонный домен (C-terminal activation domain)

GABA - гамма аминомасляная кислота (aminobutyric acid)

ECD — внеклеточный домен (extracellular domain)

HGNC - Комитет Номенклатуры Генов Человека (The HUGO Gene Nomenclature Committee)

ICD - цитоплазматический домен

IUPHAR - Международный союз фундаментальной и клинической фармакологии

(International Union of Basic and Clinical Pharmacology)

Kv - потенциал-зависимые калиевые каналы (voltage-gated K+ channels)

LG1C - лиганд-зависимые ионные каналы (ligand-gated ion channel)

nAChR - никотиновый ацетилхолиновый рецептор (nicotinic acetylcholine receptor)

PD - поровый домен (pore domain)

RMSD - среднеквадратичное отклонение координат Са-атомов (root-mean-square deviation)

TMD - трансмембранный домен

VSD - потенциал-чувствительный домен (voltage sensing domain) WT - дикий тип (wild type)

Введение диссертации (часть автореферата) на тему «Молекулярное моделирование и структурно-динамические особенности эукариотических катионных каналов»

Введение

Ионные каналы формируют большой функциональный класс интегральных трансмембранных белков и участвуют в регуляции разнообразных клеточных процессов (Jegla et al., 2009). Основной функцией ионных каналов является селективное перемещение ионов через мембрану. Наиболее распространенные и многочисленные семейства ионных каналов представлены группами лиганд-зависимых (JI3) и потенциал-зависимых (ПЗ) (Yu et al., 2004; Minor 2009) каналов, участвующих в межклеточной сигнализации. JI3 каналы генерируют электрический потенциал, превращая химические сигналы, приходящие к клетке, в электрические, а ПЗ каналы участвуют в распространении потенциала действия.

Структурное и функциональное разнообразие ионных каналов, а также их участие в работе жизненно важных систем организма обуславливает повышенный интерес к их исследованию. На сегодняшний день клонировано более 500 генов, кодирующих субъединицы ионных каналов как эукариотического происхождения, так и их бактериальных аналогов (Jegla et al., 2009). Однако сложная молекулярная архитектура эукариотических ионных каналов, в состав которых входят крупные внемембранные домены, часто является препятствием для структурных исследований экспериментальными методами (Bill et al., 2011). Так, на сегодняшний день известна лишь одна атомарная структура ПЗ калиевого канала (Kv) млекопитающих Kvl.2 (Long et al., 2005), и полноразмерная структура JI3 канала, полученная методом крио-электронной микроскопии (Miyazawa et al, 2003; Unwin 2005).

Нарушение функций JI3 и ПЗ ионных каналов может приводить к тяжелым неврологическим и наследственным заболеваниям (Bernard, Shevell, 2008; Kullmann, 2002; Kullmann, Hanna, 2002). Молекулярные механизмы дисфункции ионных каналов к настоящему времени остаются не до конца изученными, что обусловлено, в частности, недостатком данных об их структуре (Dabrowski et al., 2008, Terstappen, Reggiani, 2001). Ионные каналы составляют третью по величине группу мишеней для фармацевтических препаратов (Overington 2006; Hopkins, Groom, 2002), что во многом также обусловлено ограниченными структурными данными (Wickenden et al., 2012).

Известно, что трансмембранная часть гомологична у многих эукариотических каналов (более 20% гомологии). В связи с этим, актуальной задачей является моделирование неизвестной структуры каналов согласно опубликованным данным о гомологах и исследование поровых интерьеров и специфических участков для выявления универсальных молекулярных механизмов активности ионных каналов.

5

Целью данной диссертационной работы явилось исследование структурных и динамических свойств ЛЗ и ПЗ ионных каналов на примере моделей серотонинового 5-НТЗ рецептора человека и калиевых каналов Ку2.1 и Ку10.2 человека.

Исходя из поставленной цели, были сформулированы следующие основные задачи:

¡.Моделирование структур эукариотических катионных каналов (на примере 5-НТЗ рецептора и Ку каналов: Ку2.1, Ку10.2).

2. Анализ динамики конформационных изменений канала Ку2.1 и 5-НТЗ рецептора.

3. Структурно-динамическое сравнение селективности катионных каналов с различной симметрией.

Заключение диссертации по теме «Биофизика», Попинако, Анна Владимировна

выводы

1. Моделирование динамики построенных по гомологии моделей структур пентамерных и тетрамерных ионных каналов (серотонинового 5-НТЗ рецептора и Ку каналов Ку2.1, Ку10.2) приводит к согласующимся с экспериментальными данными об активации и кинетике переноса ионов результатам.

2. Установлено, что при открытии Ку2.1 канала сенсор потенциала У8Р значительно изменяет свое положение, двигаясь в направлении во внеклеточное пространство в пределах 4-6 А и наружу от оси поры в пределах 8-11 А.

3. Показано, что при образовании комплекса 5-НТЗ рецептора с лигандом происходит отгиб петли С на 3-4 А, стабилизация комплекса обусловлена реорганизацией водородных связей и стекинг-взаимодействиями.

4. Выявлены общие структурные закономерности функционирования эукариотических катионных каналов с различной симметрией. Показано, что селективность катионного канала определяется областью колец, сформированных консервативными остатками Е и О и стерическим фактором, образованным консервативным Т.

Заключение

В данной диссертационной работе с помощью комплексного метода моделирования впервые были получены модели каналов Ку10.2 (в открытой конформации) Ку2.1 (в открытой и закрытой конформациях) и серотонинового 5-НТЗ рецептора (в открытой и закрытой конформациях), структуры которых до настоящего времени не были кристаллизованы.

Сравнительный анализ МД расчетов каналов Ку2.1 и серотонинового 5-НТЗ рецептора в разных конформациях выявил следующую закономерность: в условиях активации открытая конформация канала является более стабильной, что подтверждает более низкое ЯМвО по сравнению с закрытым состоянием канала. Это справедливо как для ЛЗ, так и для ПЗ ионных каналов.

Для ПЗ каналов Ку2.1 в разных конформациях поровые участки канала более стабильны, чем потенциал-чувствительные домены (УБО). Значительные структурные изменения были показаны в ходе молекулярной динамики УББ доменов закрытой конформации, при этом Б1, 82, 83 и 84 спирали поворачиваются по часовой стрелке, если смотреть из внеклеточной части. Было установлено, что при открытии Ку2.1 канала сенсор потенциала 84 значительно изменяет свое положение смещением в направлении во внеклеточное пространство в пределах 4-6 А и наружу от оси поры в пределах 8-11 А.

При исследовании комплекса 5-НТЗ рецептора с серотонином методом МД было показано, что при образовании комплекса 5-НТЗ рецептора с лигандом происходит отгиб петли С на 3-4 А. Стабилизация комплекса происходит течение 1500 пс и обусловлена реорганизацией водородных связей, формированием гидрофобных и стекинг-взаимодействий. Величина расстояний между а.о. \¥85, У148, \V178 соответствует длине стекинг взаимодействий у белков: 3,4-12 А. Было установлено, что ОН группа серотонина оказывается в гидрофильном пакете и образует водородные связи с окружением. Величина длины водородной связи между серотонином и а.о. 5-НТЗ рецептора варьирует в пределах 2,4 А до 3,5 А.

Список литературы диссертационного исследования кандидат биологических наук Попинако, Анна Владимировна, 2013 год

СПИСОК ЛИТЕРАТУРЫ

1. Соколова О .С., Шайтан К.В., Гризель А.В., Попинако А.В., Карлова М.Г., Кирпичников М.П. 3D структура человеческого канала Kvl0.2 по данным электронной микроскопии макромолекул // Биофизика. 2012. Т. 2. С. 1-8.

2. Финкельштейн А.В., Птицын О.Б. Физика белка. Москва: Книжный дом Университет. 2002. С. 376.

3. Шайтан К.В., Соколова О.С., Шайтан А.К., Касимова М.А., Новоселецкий В.Н., Кирпичников М.П. Эффекты межионных взаимодействий при функционировании и ингибировании потенциал-зависимых калиевых каналов // Вестник Московского университета. Биология. 2012. Т. 16. No. 4. С. 17-23.

4. Absalom N.L., Peter R.S., Trevor M.L. Pore structure of the Cys-loop ligand-gated ion channels //Neurochemical research. 2009. V. 34. P. 1805-1815.

5. Adair В., Nunn R., Lewis S., Dukes I., Philipson L., Yeager M. Single particle image reconstruction of the human, recombinant Kv2.1 channel // Biophysical journal. 2008. V. 94. №6. P. 2106-2114.

6. Alberts В., Johnson A., Lewis J., Raff M., Roberts K., Walter P. Molecular biology of the cell, 4th edition. New York: Garland science. 2002. P. 6017-6700.

7. Albrecht В., Lorra C., Stocker M., Pongs O. Cloning and characterization of a human delayed rectifier potassium channel gene // Receptors channels. 1993. V. 1 . № 2. P. 99-110.

8. Alder B.J., Wainwright Т.Е. Phase Transition for a hard sphere system // Journal of chemical physics. 1957. V. 27. P. 1208-1209.

9. Alexeev Y., Mazanetz M.P., Ichihara O., Fedorov D.G. GAMESS as a free quantum-mechanical platform for drug research // Current topics in medicinal chemistry. 2012. V. 12 № 18. 20132033.

10. Allen M.P., Tildesley D.J. Computer simulation of liquids. Oxford: Oxford university press. 1989. P. 408.

11. Al-Owais M., Bracey K., Wray D. Role of intracellular domains in the function of the herg potassium channel // European biophysics journal. 2009. V. 38. № 5. P. 569-576.

12. Anderson P.A., Greenberg R.M. Phylogeny of ion channels: clues to structure and function // Comparative biochemistry and physiology. Part B: Biochemistry and molecular biology. 2001. V. 129. P. 17-18.

13. Archer S.L., Wu X.C., Therbaud В., Nsair A., Bonnet S., Tyrrell В., McMurtry M.S., Hashimoto K., Harry G., Michelakis E.D. Preferential expression and function of voltage-gated, 02-sensitive K+ channels in resistance pulmonary arteries explains regional heterogeneity in hypoxic pulmonary vasoconstriction: ionic diversity in smooth muscle cells // Circulation research. 2004. V. 95. P. 308-318.

14. Barnes N.M., Hales T.G., Lummis S.C., Peters J.A. The 5-HT3 receptor-the relationship between structure and function // Neuropharmacology. 2009. V. 56. № 1. P. 273-284.

15. Ba§tug Т., KuyucakS. Comparative study of the energetics of ion permeation in Kvl.2 and KcsA potassium channels // Biophysical journal. 2011. V. 100. № 3. 629-636.

16. Bauer C.K., Schwarz J.R. Physiology of EAG КС channels // Journal of membrane Biology. 2001. V. 182. P. 1-15.

17. Beckstein, O., Biggin P. C., Sansom M. S. P. A hydrophobic gating mechanism for nanopores //Journal of physical chemistry B. 2001. V. 105 P. 12902-12905.

18. Beckstein O., Sansom M.S. A hydrophobic gate in an ion channel: the closed state of the nicotinic acetylcholine receptor // Physical biology. 2006. V. 3. № 2. P. 147-159.

19. Berendsen H.J., Van Gunsteren W.F., Zwinderman H.R., Geurtsen R.G. Simulations of proteins in water // Annals of the New York academy of sciences. 1986. V. 482. P. 269-86.

20. Bernard G., Shevell M.I. Channelopathies: a review // Pediatric neurology. 2008. V. 38. № 2. P. 73-85.

21. Brazier M.A. A history of neurophysiology in the 19th century. Raven Press, New York, 1988.

22. Brejc K., van Dijk W.J., Klaassen R.V., Schuurmans M., van Der Oost J., Smit A.B., Sixma T.K. Crystal structure of an ACh-binding protein reveals the ligand-binding domain of nicotinic receptors // Nature. 2001. V. 411. P. 269-276.

23. Brelidze T.I., Carlson A.E., Zagotta W.N. Absence of direct cyclic nucleotide modulation of mEAGl and hERGl channels revealed with fluorescence and electrophysiological methods // Journal of biological chemistry. 2009. V. 284. № 41. P. 27989-27997.

24. Brelidze T.I., Carlson A.E., Davies D.R., Stewart L.J., Zagotta W.N. Identifying regulators for EAG1 channels with a novel electrophysiology and tryptophan fluorescence based screen // PLoS. One. 2010. V. 5. № 9. P. 12523.

25. Brelidze T.I., Carlson A.E., Sankaran B., Zagotta W.N. Structure of the carboxy-terminal region of a KCNH channel // Nature. 2012. V. 481. № 7382. P. 530-533.

26. Brooks B.R., Bruccoleri R.E., Olafson B.D., States D.J., Swaminathan S., Karplus M. "CHARMM: A program for macromolecular energy, minimization, and dynamics calculations" // Journal of computational chemistry. 1983. V. 4. № 2. P. 187-217.

27. Biggin P.C., Sansom M.S. Open-state models of a potassium channel // Biophysical journal. 2002. V. 83. № 4. P. 1867-1876.

28. Bill R.M., Henderson P.J., Iwata S., Kunji E.R., Michel H., Neutze R., Newstead S., Poolman B., Tate C.G., Vogel H. Overcoming barriers to membrane protein structure determination // Nature biotechnology. 2011. V. 29. № 4. P.335-340.

29. Bocquet N., Nury H., Baaden M., Poupon C.L., Changeux J., Delarue M., Corringer P.J. X-ray structure of a pentameric ligand-gated ion channel in an apparently open conformation // Nature. 2009 V. 457. №7225. P. 111-114.

30. Brenner R., Wilcox K.S. Potassium channelopathies of epilepsy// Epilepsia. 2010. V. 51. P. 60.

31. Burley S.K. PDB40: the protein data bank celebrates its 40th birthday // Biopolymers. 2013. V. 99. № 3. P. 165-169.

32. Cabral J.H., Lee A., Cohen S.L., Chait B.T., Li M., Mackinnon R. Crystal structure and functional analysis of the HERG potassium channel N terminus: a eukaryotic PAS domain // Cell. 1998. V. 95. P. 649-655.

33. Campomanes C.R., Carroll K.I., Manganas L.N., Hershberger M.E., Gong B., Antonucci D.E., Rhodes K.J., Trimmer J.S. Kv beta subunit oxidoreductase activity and Kvl potassium channel trafficking // Journal of biological chemistry. 2002. V. 277. № 10. P. 8298-8305.

34. Capener C.E., Kim H.J., Arinaminpathy Y., Sansom M.S. Ion channels: structural bioinformatics and modelling // Human molecular genetics. 2002. V. 11. № 20. P. 2425-2433.

35. Cartaud J., Benedetti E.L., Cohen J.B., Meunier J.C., Changeux J.P. Presence of a lattice structure in membrane fragments rich in nicotinic receptor protein from the electric organ of Torpedo marmorata // FEBS JOURNAL Letters. 1973. V. 15. № 1. P. 109-113.

36. Celie P.H., Klaassen R.V., van Rossum-Fikkert S.E., van Elk R., van Nierop P., Smit A.B., Sixma T.K. Crystal structure of acetylcholine-binding protein from Bulinus truncatus reveals the conserved structural scaffold and sites of variation in nicotinic acetylcholine receptors // Journal of biological chemistry. 2005. V. 280. № 28. P. 26457-26466.

37. Chen G.Q., Cui C., Mayer M.L., Gouaux E. Functional characterization of a potassium-selective prokaryotic glutamate receptor // Nature. 1999. V. 402. № 6763. P. 817-821.

38. Chen S., Wang J., Siegelbaum S.A. Properties of hyperpolarization-activated pacemaker current defined by coassembly of HCN1 and HCN2 subunits and basal modulation by cyclic nucleotide // Journal of general physiology. 2001. V. 117. № 5. P. 491-504.

39. Cheng X., Wang H., Grant B., Sine S.M., MeCammon J.A. Targeted molecular dynamics study of C-loop closure and channel gating in nicotinic receptors // PLOS computational biology. 2006. V. 2. № 9. P. el34.

40. Chen X., Wang Q., Ni F., Ma J. Structure of the full-length Shaker potassium channel Kvl.2 by normal-mode-based X-ray crystallographic refinement // Proceedings of the National Academy of Sciences. 2010. V. 107. №25. P. 11352-11357.

41. Chiu P.L., Pagel M.D., Evans J., Chou H.T., Zeng X., Gipson B., Stahlberg H., Nimigean C.M. The structure of the prokaryotic cyclic nucleotide-modulated potassium channel MloKl at 16 A resolution// Structure. 2007. V. 15. P. 1053-1064.

42. Clamp M., Fry B., Kamal M„ Xie X., Cuff J., Lin M. F., Kellis M„ Lindblad-Toh K., Lander, E. S. Distinguishing protein-coding and noncoding genes in human genome // Proceedings of the National Academy of Sciences. 2007. V. 104. № 19428-19433.

43. Clarke E., Jacyna L.S. Nineteenth-century origins of neuroscientific concepts. Berkeley: University of California Press. 1988. P. 5-74.

44. Clarke E., Jacyna L.S. "Nineteenth-century origins of neuroscientific concepts". By Edwin Clarke and L. S. Jacyna. Essay review // Medical history. 1987. V. 32. № 2. P. 211-213.

45. Clayton G.M., Altieri S., Heginbotham L., Unger V.M., Morais-Cabral J.H. Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated hannel // Proceedings of the National Academy of Sciences. 2008. V. 105. P. 1511-1515.

46. Cohen J.B., Weber M., Huchet M., Changeux J.P. // FEBS JOURNAL Letters. 1972 V. 26. № 1. P. 43-7.

47. Collingridge G.L., Olsen R.W., Peters J., Spedding M. A nomenclature for ligand-gated ion channels //Neuropharmacology. 2009. V. 56. № 1. P. 2-5.

48. Connolly C.N., Wafford K.A. The Cys-loop superfamily of ligand-gated ion channels: the impact of receptor structure on function // Biochemical society transactions. 2004. V. 32. P. 529534.

49. Corringer P.J., Nov'ere N.L., Changeux J.P. Nicotinic receptors at the amino acid level // Annual review of pharmacology and toxicology. 2000. V. 40. P. 431-458.

50. Corringer P.J., Baaden M., Van Renterghem C. Atomic structure and dynamics of pentameric ligand-gated ion channels: new insight from bacterial homologues // Journal of physiology. 2010. V. 588. P.565-572.

51. Corry B., Thomas M. Mechanism of ion permeation and selectivity in a voltage gated sodium channel //Journal of the american chemical society. 2012. V. 134. № 3. P. 1840-1846.

52. Craven K.B., Zagotta W.N. CNG and HCN channels: two peas, one pod // Annual review of physiology. 2006. V. 68. P. 375-401.

53. Cymes G.D., Grosman C. The unanticipated complexity of the selectivity-filter glutamates of nicotinic receptors //Nature chemical biology. 2012. V. 8. № 12. P. 975-981.

54. Dabrowski M.A., Dekermendjian K., Lund P.E., Krupp J.J., Sinclair J., Larsson O. Ion channel screening technology // CNS & Neurological Disorders - Drug Targets. 2008. V. 7. № 2. P.122-128.

55. Darden, T.A., Pedersen L.G. Molecular modeling: an experimental tool // Environmental health perspectives. 1993. V. 101. № 5. P. 410-412.

56. del Camino D., Kanevsky M., Yellen G. Status of the intracellular gate in the activated-not-open state of shaker K+ channels // Journal of general physiology. 2005. V. 126 P. 419-428.

57. Delemotte L., Tarek M., Klein M.L., Amaral C., Treptow W. Intermediate states of the Kvl.2 voltage sensor from atomistic molecular dynamics simulations. // Proceedings of the National Academy of Sciences. 2011. V. 108. № 15. P. 6109-6114.

58. Doyle D.A., Cabral M.J., Pfuetzner R.A., Kuo A., Gulbis J.M., Cohen S.L., Chait B.T., MacKinnon R. The structure of the potassium channel: molecular basis of K+ conduction and selectivity // Science. 1998. V. 280. № 5360. P. 69-77.

59. Drain P., Dubin A.E., Aldrich R.W. Regulation of Shaker K+ channel inactivation gating by the cAMP-dependent protein kinase // Neuron. 1994. V. 12. № 5. P. 1097-1109.

60. Dutzler R. A structural perspective on C1C channel and transporter function // FEBS Letters. 2007. V. 581. P. 2839-2844.

61. Durdagi S., Deshpande S., Duff H.J., Noskov S.Y. Modeling of open, closed, and open-inactivated states of the hERGl channel: structural mechanisms of the state-dependent drug binding // Journal of chemical information and modeling. 2012. V. 52. № 10. P. 2760-2774.

62. Essmann U., Perera L., Berkowitz M.L., Darden T. A smooth particle mesh ewald method // Journal of chemical physics. 1995. V. 103. P. 8577-8593.

63. Farber L., Haus U., Späth M., Drechsler S. Physiology and pathophysiology of the 5-HT3 receptor// Scandinavian journal of reumatology. Supplement. 2004. V. 119. P. 2-8.

64. Fiebich B.L., Akundi R.S., Seidel M., Geyer V., Haus U., Müller W., Stratz T., Candelario-Jalil E. Expression of 5-HT3A receptors in cells of the immune system // Scandinavian journal of rheumatology. 2004. V. 119. P. 9-11.

65. Fiser A., Sali A. Modeller: Generation and refinement of homology-based protein structure models // Methods ynzymology. 2003. V. 374. P. 461-491.

66. Förster F., Webb B., Krukenberg K.A., Tsuruta H„ Agard D.A., Sali A. Integration of small-angle X-ray scattering data into structural modeling of proteins and their assemblies // Journal of molecular biology. 2008. V. 382. № 4. P. 1089-1106.

67. Franciolini F., Petris A. Evolution of ionic channels of biological membranes // Molecular biology and evolution. 1989. V. 6. № 5. P. 503-513.

68. Froimowitz M.P. HyperChem a software package for computational chemistry and molecular modeling//Biotechniques. 1993. V. 14. №6. P. 1010-1013.

69. Galligan J.J. Ligand-gated ion channels in the enteric nervous system // Neurogastroenterology and motility. 2002. V. 14. № 6. P. 611-623.

70. Garcia-Ferreiro R.E., Kerschensteiner D., Major F., Monje F., Stühmer W., Pardo L.A. Mechanism of block of hEagl K+ channels by imipramine and astemizole // Journal of general physiology. 2004. V. 124. № 4. P. 301-317.

71.Goddard T.D., Ferrin T.E. Visualization Software for Molecular Assemblies // Current Opinion in Structural Biology. 2007. V. 17. № 5. P. 587-595.

72. Goddard T.D., Huang C.C., Ferrin T.E., Software extensions to UCSF Chimera for interactive visualization of large molecular assemblies // Structure. 2005. V. 13. P. 473-482.

73. Gouaux E., Mackinnon R. Principles of selective ion transport in channels and pumps // Science. 2005. V. 310. P. 1461-1465.

74. Gustina A.S., Trudeau M.C. hERG potassium channel gating is mediated by N- and C-terminal region interactions // Journal of general physiology. 2011. V. 137. № 3. P. 315-325.

75. Han M., Zhang J.Z. Molecular dynamic simulation of the Kvl.2 voltage-gated potassium channel in open and closed state conformations // Journal of physical chemistry. 2008. V. 112. № 51. P. 16966-16974.

76. Hansen S.B., Talley T.T., Radic Z., Taylor P. Structural and ligand recognition characteristics of an acetylcholine-binding protein from Aplysia californica // Journal of biological chemistry. 2004. V. 279. № 23. P. 24197-241202.

77. Hess B., Bekker H., Berendsen H.J., Fraaije J.G., Lines. P. A linear constrant solver for molecular simulation // Journal of computational chemistry. 1997. V. 18. P. 1463-1472.

78. Hess N.J., Bowden M.E., Parvanov V.M., Mundy C., Kathmann S.M., Schenter G.K., Autrey T. Spectroscopic studies of the phase transition in ammonia borane. P. Raman spectroscopy of single crystal NH3BH3 as a function of temperature from 88 to 330 K // Journal of chemical physics. 2008. V. 128. № 3. P. 034508.

79. Hilf R.J., Dutzler R. X-ray structure of a prokaryotic pentameric ligand-gated ion channel // Nature. 2008. V. 452. № 7185. P. 375-379.

80. Hilf R.J., Dutzler R. // Nature. 2009. V. 457. № 7225. P. 115-118.

81. Hille B. Ionic channels of excitable membranes, 3rd edn. Sunderland: Sinauer Associates Inc. 2001. P. 23-274.

82. Hodgkin A.L., Huxley A.F. Currents carried by sodium and potassium ions through the membrane of the giant axon of Loligo // Journal of physiology. 1952. V. 116. P. 449-472.

83. Holmes T.C., Fadool D.A., Levitan I.B. Tyrosine phosphorylation of the Kvl.3 potassium channel // Journal of neuroscience. 1996. V. 16. № 5. P. 1581-1590.

84. Hopkins A.L., Groom C.R. The druggable genome // Nature reviews drug discovery. 2002. V. 1. P. 727-730.

85. Hopp T.P., Woods K.R. Prediction of protein antigenic determinants from amino acid sequences // Proceedings of the National Academy of Sciences. 1981. V. 78. № 6. P. 3824-3828.

86. Horn R., Ding S., Gruber H.J. Immobilizing the moving parts of voltage-gated ion channels // Journal of general physiology. 2000. V. 116. P. 461-476.

87. Hsin J., Arkhipov A., Yin Y., Stone J.E., Schulten K. Using VMD: an introductory tutorial // Current protocols in bioinformatics. 2008. V. 5. P. 5-7.

88. Humphrey W., Dalke A., Schulten K. VMD - Visual Molecular Dynamics // Journal of molecular graphics 1996. V. 14. P. 33-38.

89. Ikeda M., Tomita Y., Mouri A., Koga M., Okochi T., Yoshimura R., Yamanouchi Y., Kinoshita Y., Hashimoto R., Williams H.J., Takeda M., Nakamura J., Nabeshima T., Owen M.J., O'Donovan M.C., Honda H., Arinami T., Ozaki N., Iwata N. Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches // Biological psychiatry. 2010. V. 67. № 3. P. 263-269.

90. Jansen M., Bali M., Akabas M.H. Modular design of Cys-loop ligand-gated ion channels: functional 5-HT3 and GAB A rhol receptors lacking the large cytoplasmic M3M4 loop // Journal of general physiology. 2008. V. 131. № 2. P. 137-46.

91. Jasti J., Furukawa H., Gonzales E.B., Gouaux E. Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH // Nature. 2007. V. 449. № 7160. P. 316-323.

92. Jegla T.J., Zmasek C.M., Batalov S., Nayak S.K. Evolution of the human ion channel set // Combinatorial chemistry and high throughput screening. 2009. V. 12. № 1. P. 2-23.

93. Jensen M.O., Borhani D.W., Lindorff-Larsen K., Maragakiis P., Jogini V., Eastwood M.P., Dror R.O., Shaw D.E. Principles of conduction and hydrophobic gating in K+ channels // Proceedings of the National Academy of Sciences. 2010. V. 107. № 13. P. 5833-5838.

94. Jensen M.O., Jogini V., Borhani D.W., Leffler A.E., Dror R.O., Shaw D.E. Mechanism of voltage gating in potassium channel // Science. 2012. V. 336. № 6078. P. 229233.

95. Jentsch T.J. Chloride channels are different // Nature. 2002. V. 415. P. 276-277.

96. Jiang Y., Lee A., Chen J., Cadene M., Chait B.T., MacKinnon R. Crystal structure and mechanism of a calcium-gated potassium channel // Nature. 2002. V. 417. № 6888. P. 515-522.

97. Jorgensen W.L., Maxwell D.S., Tirado-Rivers J. Development and testing of the OPLS all-atom force field on conformational energetics and properties of organic liquids // Journal of the American chemical society. 1996. V. 118. P. 11225-11236.

98. Jorgensen W.L., Chandrasekhar J., Madura J.D. Comparison of simple potential function for simulation liquid water // Journal of chemical physics. 1983. V. 79. P. 926-935.

99. Ju M., Stevens L., Leadbitter E., Wray D. The Roles of N- and C-terminal determinants in the activation of the Kv2.1 potassium channel // Journal of biological chemistry. 2003. V. 278. № 15. P. 12769-12778.

100. Ju M., Wray D. Molecular identification and characterization of human EAG2 potassium channel // FEBS Letters. 2002. V. 524. № 1-3. P. 204-210.

101. Ju M., Wray D. Molecular regions responsible for differences in activation between heag channels // Biochemical and biophysical research communications. 2006. V. 342. № 4. P. 108810897.

102. Kaczanowski S., Zielenkiewicz P. Why similar protein sequences encode similar three-dimensional structures? // Theoretical chemistry accounts. 2010. V. 125. P. 643-650.

103. Kalamida D., Poulas K., Avramopoulou V., Fostieri E., Lagoumintzis G., Lazaridis K., Sideri A., Zouridakis M., Tzartos S.J. Muscle and neuronal nicotinicacetylcholine receptors. Structure, function and pathogenicity // FEBS Journal. 2007. V. 274. P. 3799-3845.

104. Karplus M., McCammon J.A. Protein structural fluctuations during a period of 100 ps // Nature. 1979. V. 277. P. 578.

105. Katz B. Nerve, Muscle, and Synapse. New York: McGraw-Hill. 1966. P. 243.

106. Kawate T., Michel J.C., Birdsong W.T., Gouaux E. Crystal structure of the ATP-gated P2X:(4) ion channel in the closed state // Nature. 2009. V. 460. P. 592-598.

107. Kesters D., Thompson A.J., Brams M., van Elk R., Spumy R., Geitmann M., Villalgordo J.M., Guskov A., Danielson U.H., Lummis S.C., Smit A.B., Ulens C. Structural basis of ligand recognition in 5-HT3 receptors // EMBO Rep. 2013. V. 14. № 1. P. 49-56.

108. Kiefer F„ Arnold K., Kiinzli M„ Bordoli L., Schwede T. The SWISS-MODEL Repository and associated resources // Nucleic acids research. 2009. V. 37. P. D387-D392.

109. Kim L.A., Furst J., Gutierrez D., Butler M.H., Xu S., Grigorieff N. Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21A resolution // Neuron. 2004. V. 41. № 4. P. 513-519.

110. Kistler J., Stroud R.M. Crystalline arrays of membrane-bound acetylcholine receptor. // Proceedings of the National Academy of Sciences. 1981. V. 78. № 6. P. 3678-3682.

111.Kovacs J.A., Baker K.A., Altenberg G.A., Abagyan R., Yeager M. Molecular modeling and mutagenesis of gap junction channels // Progress in biophysics and molecular biology. 2007. V. 94. № 1-2. P. 15-28.

112. Kozuska J.L., Paulsen I.M. The Cys-loop pentameric ligand-gated ion channel receptors: 50 years on // Canadian journal of physiology and pharmacology. 2012. V. 90. № 6. P. 771-782 .

113. Khalili-Araghi F., Jogini V., Yarov-Yarovoy V., Tajkhorshid E., Roux B., Schulten K. Calculation of the gating charge for the Kvl.2 voltage-activated potassium channel // Biophysical journal. 2010. V. 98. № 10. P. 2189-2198.

114. Krieger E., Nabuurs S.B., Vriend G. Structural Bioinformatics. Edited by Bourne P.E. and Weissig H. 2003. New-York: Wiley-Liss, Inc. P. 56-163.

115. Krzywkowski K. Do polymorphisms in the human 5-HT3 genes contribute to pathological phenotypes? // Biochemical society transactions. 2006. V. 34. P. 872-876.

116. Kullmann D.M. The neuronal channelopathies // Brain. 2002. V. 125. P. 1177-1195.

117. Kullmann D..M., Hanna M.G. Neurological disorders caused by inherited ion-channel mutations // Lancet neurology. 2002. V. 1. № 3. P. 157-166.

118. Kuo A., Gulbis J.M., Antcliff J.F., Rahman T., Lowe E.D., Zimmer J., Cuthbertson J., Ashcroft F.M., Ezaki T., Doyle D.A. Crystal structure of the potassium channel KirBacl.l in the closed state // Science. 2003. V. 300. № 5627. P. 1922-1926.

119. Kuo M.M., Haynes W.J., Loukin S.H., Kung C., Saimi Y. Prokaryotic K(+) channels: from crystal structures to diversity // FEMS microbiology reviews. 2005. V. 29. № 5. P. 961-985.

120. Labro A.J., Raes A.L., Grottesi A., Van Hoorick D., Sansom M.S., Snyders D.J. Channel gating requires a compatible S4-S5 linker and bottom part of S6, constrained by non-interacting residues. // Journal of general physiology. 2008. V. 132. № 6. P. 667-680.

121.LeeC.Y., Tseng L.F. Distribution of Bungarus multicinctus venom following envenomation // Toxicon. 1966. V. 3. № 4. P. 281-290.

122. Leicher T„ Bahring R., Isbrandt D., Pongs O. Coexpression of the KCNA3B gene product with Kvl.5 leads to a novel A-type potassium channel // Journal of biological bhemistry. 1998. V. 273. №52. P. 35095-35101.

123. Lemak A.S., Balabaev N.K. Molecular dynamics simulation of a polymer chain in solution by collisional dynamics method // Journal of computational chemistry. 1996. V. 17. № 15. P. 16851695.

124. Lester H.A., Dibas M.I., Dahan D.S., Leite J.F., Dougherty D.A. Cys-loop receptors: new twists and turns // Trends in neurosciences. 2004. V. 27. № 6. P. 329-336.

125. Lesyng B., McCammon J.A. Molecular modeling methods. Basic techniques and challenging problems // Pharmacology and therapeutics. 1993. V. 60. № 2. P. 149-67.

126. Li Y., Um S.Y., McDonald T.V. Voltage-gated potassium channels: regulation by accessory subunits //Neuroscientist. 2006. V. 12. № 3. P. 199-210.

127. Lindstrom J., Walter B., Einarson B. Immunochemical similarities between subunits of acetylcholine receptors from Torpedo, Electrophorus, and mammalian muscle // Biochemistry. 1979. V. 18. № 21. P. 4470-4480.

128. Lim S.T., Antonucci D.E., Scannevin R.H., Trimmer J.S. A novel targeting signal for proximal clustering of the Kv2.1 K+ channel in hippocampal neurons // Neuron. 2000. V. 25. № 2. P. 385397.

129. Long S.B., Campbell E.B., Mackinnon R. Crystal structure of a mammalian voltage-dependent Shaker family K+ channel // Science. 2005. V. 309 . № 5736. P. 897-903.

130. Long S.B., Tao X., Campbell E.B., MacKinnon R. Atomic structure of a voltage-dependent K+ channel in a lipid membrane-like environment // Nature. 2007. V. 450. № 7168. P. 376-382.

131.Lovinger D.M. 5-HT3 receptors and the neural actions of alcohols: an increasingly exciting topic //Neurochemistry international. 1999. V. 35. № 2. P. 125-130.

132. Lu D., Aksimentiev A., Shih A.Y., Cruz-Chu E., Freddolino P.L., Arkhipov A., Schulten K. The role of molecular modeling in bionanotechnology // Physical biology. 2006. V. 3. № 1. P. S40-53.

133. Ludwig J., Weseloh R., Karschin C., Liu Q., Netzer R., Engeland B., Stansfeld C., Pongs O. Cloning and functional expression of rat eag2, a new member of the ether-a-go-go family of potassium channels and comparison of its distribution with that of eagl // Molecular and cellular neurosciences. 2000. V. 16. № 1. P. 59-70.

134. Lummis S.C. The transmembrane domain of the 5-HT3 receptor: its role in selectivity and gating // Biochemical society transactions. 2004. V. 32. P. 535-539.

135. Lummis S.C., Beene D.L., Lee L.W., Lester H.A., Broadhurst R.W., Dougherty D.A. // Nature. 2005 Nov 10. V. 438. № 7065. P. 248-252.

136. MacDonald P.E., Ha X.F., Wang J., Smukler S.R., Sun A.M., Gaisano H.Y., Salapatek A.M., Backx P.H. Wheeler M.B. Members of the Kvl and Kv2 voltage-dependent K(+) channel families regulate insulin secretion // Molecular endocrinology. 2001. V. 15. № 8. P. 1423-1435.

137. MacDonald P.E., Wang G„ Tsuk S., Dodo C., Kang Y„ Tang L., Wheeler M.B., Cattral M.S., Lakey J.R., Salapatek A.M., Lotan I., Gaisano H.Y. Synaptosome-associated protein of 25 kilodaltons modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells

through an interaction with the channel N terminus // Molecular endocrinology. 2002. V. 16. № 11. P. 2452-2461.

138. MacKinnon R. Potassium channels and the atomic basis of selective ion conduction (Nobel Lecture) // Angewandte chemie. 2004.V. 43. № 33. P. 4265-4277.

139. Maffeo C., Bhattacharya S., Yoo J., Wells D., Aksimentiev A. Modeling and simulation of ion channels // Chemical reviews. 2012. V. 112. P. 6250-6284.

140. Maksay G. Ligand-gated pentameric ion channels, from binding to gating // Current molecular pharmacology. 2009. V. 2. № 3. P. 253-262.

141. Maricq A.V., Peterson A.S., Brake A.J., Myers R.M., Julius D. Primary structure and functional expression of the 5HT3 receptor, a serotonin-gated ion channel // Science. 1991. V. 254. № 5030. P. 432-437.

142. Martin S., Lino-de-Oliveira C., Joca S.R., Weffort de Oliveira R., Echeverry M.B., Da Silva C.A., Pardo L.,Stuhmer W., Bel E.D. Eag 1, Eag 2 and Kcnn3 gene brain expression of isolated reared rats // Genes, brain and behavior. 2010. V. 9. № 8. P. 918-924.

143. Martini J., Hellmich W„ Greif D., Becker A., Merkle T., Ros R., Ros A., Toensing K., Anselmetti D. Systems nanobiology: from quantitative single molecule biophysics to microfluidic-based single cell analysis // Sub-cellular biochemistry. 2007. V. 43. P. 301-321.

144. McCammon J.A., Celin B.R., Karplus G.M. Dynamics of folded proteins // Nature. 1977. V. 267. P. 585-590.

145. McCammon J.A., Karplus G.M. Dynamics of activated processes in globular proteins // Proceedings of the national academy of sciences of United States of America. 1979. V. 76. P. 3585-3589.

146. Misonou H., Mohapatra D.P., Trimmer J.S. Kv2.1: a voltage-gated k+ channel critical to dynamic control of neuronal excitability // Neurotoxicology. 2005. V. 26. № 5. P. 743-752.

147. Misonou H., Trimmer J.S. Determinants of voltage-gated potassium channel surface expression and localization in Mammalian neurons // Critical reviews of biochemistry and molecular biology. 2004. V. 39. № 3. P. 125-145.

148. Minor D.L. An Overview of Ion Channel Structure. In: Bradshaw R.A., Dennis E.A. editors, Handbook of cell signaling 2nd edition. Oxford: Academic Press. 2009. P. 201-207.

149. Miyamoto S., Komagoe K.. Settle P. An analytical version of the shake and rattle algorithm for rigid water models // Journal of computational chemistry. 1992.V. 13. P. 952-962.

150. Miyazawa A., Fujiyoshi Y., Unwin N. Structure and gating mechanism of the acetylcholine receptor pore // Nature. 2003. V. 423. № 6943. P. 949-955.

151. Mohapatra D.P., Siino D.F., Trimmer J.S. Interdomain cytoplasmic interactions govern the intracellular trafficking, gating, and modulation of the Kv2.1 channel // Journal of neurosciences. 2008. 28. № 19. P. 4982-4994.

152. Mokrab Y., Bavro V.N., Mizuguchi K„ Todorov N.P., Martin I.L., Dunn S.M., Chan S.L., Chau P.L. Exploring ligand recognition and ion flow in comparative models of the human GABA type A receptor. Journal of molecular graphics and modelling. 2007. V. 26. № 4. P. 76074.

153. Moorhouse A.J., Keramidas A., Zaykin A., Schofield P.R., Barry P.H. Single channel analysis of conductance and rectification in cation-selective, mutant glycine receptor channels. // Journal of general physiology. 2002. V. 119. P. 411-425.

154. Murata Y., Iwasaki H. Sasaki M., Inaba K., Okamura Y. Phosphoinositide phosphatase activity coupled to an intrinsic voltage sensor // Nature 2005. V. 435. № 7046. P. 1239-43.

155. Nishiyama A., Kambe F., Kamiya K., Seo H., Toyama J. Effects of thyroid status on expression of voltage-gated potassium channels in rat left ventricle // Cardiovascular research. 1998. V. 40. №2 P. 343-351.

156. Noda M., Takahashi H., Tanabe T., Toyosato M., Kikyotani S., Furutani Y., Hirose T., Takashima H., Inayama S., Miyata T., Numa S. Structural homology of Torpedo californica acetylcholine receptor subunits // Nature. 1983. V. 302. № 5908. P. 528-532.

157. Noda M., Ikeda T., Suzuki H., Takeshima H., Takahashi T., Kuno M., Numa S. Expression of functional sodium channels from cloned cDNA // Nature. 1986. V. 322. № 6082. P. 826-828.

158.Notredame C., Higgins D.G., Heringa J. T-Coffee: a novel method for fast and accurate multiple sequence alignment // Journal of molecular biology. 2000. V. 302. № 1. P. 205-217.

159. Novikov F.N., Stroylov V.S., Zeifman A.A., Stroganov O.V., Kulkov V., Chilov G.G. Lead Finder docking and virtual screening evaluation with Astex and DUD test sets // Journal of computer-aided molecular design. 2012. V. 26. № 6. P. 725-735.

160. Oliveira R.M., Martin S., de Oliveira C.L., Milani H., Schiavon A.P., Joca S., Pardo L.A., Stuhmer W., Del Bel E.A. Eagl, Eag2, and SK3 potassium channel expression in the rat hippocampus after global transient brain ischemia // Journal of neuroscience research. 2012. V. 90. № 3. P. 632-640.

161,Orlova E.V., van Heel M. Structure of keyhole limpet hemocyanine Type 1 (KLH1) at 15A resolution by electron cryomicroscopy and angular reconstitution // Journal of Molecular Biology. 1997. V. 271. P.417-437.

162. Overington J.P., Al-Lazikani B., Hopkins A.L. How many drug targets are there? // Nature reviews. Drug discovery. 2006. V. 5. № 12. P. 993-996.

163. Pandurangan A.P., Topf M. Finding rigid bodies in protein structures: application to flexible fitting into cryoEM maps // Journal of structural biology. 2012. V. 177. № 2. P. 520-531.

164. Papazian D.M., Schwarz T.L., Tempel B.L., Jan Y.N., Jan L.Y.Cloning of genomic and complementary DNA from Shaker, a putative potassium channel gene from Drosophila // Science. 1987. V. 237. № 4816. P. 749-753.

165. Parikh R.B., Bali M., Akabas M.H. Structure of the M2 transmembrane segment of GLIC, a prokaryotic Cys loop receptor homologue from Gloeobacter violaceus, probed by substituted cysteine accessibility//Journal of biological chemistry. 2011. V. 286. № 16. P. 14098-14109.

166. Park K.S., Mohapatra D.P., Misonou H., Trimmer J.S. Graded regulation of the Kv2.1 potassium channel by variable phosphorylation // Science. 2006. V. 313. № 5789. P. 976-979.

167. Pasenkiewicz-Gierula M., Takaoka Y., Miyagawa H., Kitamura K., Kusumi A. Charge pairing of headgroups in phosphatidylcholine membranes: a molecular dynamics simulation study // Biophysical journal. 1999. V. 76. № 3. P. 1228-1240.

168.Pathak M.M., Kurtz L., Tombola F., Isacoff E. The cooperative voltage sensor motion that gates a potassium channeln // Journal of general physiology. 2005. V. 125. P. 57-69.

169. Pathak M.M., Yarov-Yarovoy V., Agarwal G., Roux B., Barth P., Kohout S., Tombola F., Isacoff E.Y. Closing in on the resting state of the shaker K + channel // Neuron. 2007. V. 56. № l.P. 124-140.

170. Patra M., Karttunen M., Hyvonen M.T., Falck E., Lindqvist P., Vattulainen I. Molecular dynamics simulations of lipid bilayers: major artifacts due to truncating electrostatic interactions // Biophysical journal. 2003. V. 84. № 6. P. 3636-3645.

171. Pellequer J.L., Brudler R., Getzhoff E.D. Biological sensors. More than one way to sense oxygen // Current biology. 1999. V. 9. № 11. P. 416-418.

172. Peters J.A., Carland J.E., Cooper M.A., Livesey M.R., Deeb T.Z., Hales T.G., Lambert J.J. Novel structural determinants of single-channel conductance in nicotinic acetylcholine and 5-hydroxytryptamine type-3 receptors // Biochemical society transactions. 2006. V. 34. P. 882-886.

173. Pettersen E.F., Goddard T.D., Huang C.C., Couch G.S., Greenblatt D.M., Meng E.C., Ferrin T.E. UCSF Chimera - a visualization system for exploratory research and analysis // Journal of Computational Chemistry. 2004. V. 25. P. 1605-1612.

174. Phillips J.C., Braun R., Wang W., Gumbart J., Tajkhorshid E., Villa E., Chipot C„ Skeel R.D., Kalé L., Schulten K. Scalable molecular dynamics withNAMD // Journal of computational chemistry. 2005. V. 26. № 16. P. 1781-1802.

175. Pischalnikova A.V., Sokolova O.S. The domain and conformational organization in potassium voltage-gated ion channels //Journal of neuroimmune pharmacology. 2009. V. 4. № 1. P. 71-82.

176. Raftery M.A., Hunkapiller M.W., Strader C.D., Hood L.E. Acetylcholine receptor: complex of homologous subunits // Science. 1980. V. 208. № 4451. P. 1454-1456.

177. Rahman A. Correlations in the motion of atoms in liquid argon // Physical review letters. 1964. V. 136. P.405-411.

178. Reeves D.C., Lummis S.C. The molecular basis of the structure and function of the 5-HT3 receptor: a model ligand-gated ion channel (review) // Molecular membrane biology. 2002. V. 19. № l.P. 11-26.

179. Reeves D.C., Sayed M.F., Chau P.L., Price K.L., Lummis S.C. Prediction of 5-HT3 receptor agonist-binding residues using homology modeling // Biophysical journal. 2003. V. 84. № 4. P. 2338-2344.

180. Renart M.L., Montoya E., Fernández A.M., Molina M.L., Poveda J.A., Encinar J.A., Ayala J.L., Ferrer-Montiel A.V., Gómez J., Morales A., González Ros J.M. Contribution of ion binding affinity to ion selectivity and permeation in KcsA, a model potassium channel // Biochemistry. 2012. V. 51. № 18. P. 3891-3900.

181.Rossky P.J., Karplus M. Solvation. A molecular dynamics study of a dipeptide in water // Journal of the American Chemical society. 1979. V. 101. P. 1913-1937.

182. Roux B., Allen T., Bernéche S., Im W. Theoretical and computational models of biological ion channels // Quarterly reviews of biophysics. 2004. V. 37. № 1. P. 15-103.

183. Roux B., Bernéche S., Im W. Ion channels, permeation, and electrostatics: insight into the function of KcsA // Biochemistry. 2000. V. 39. № 44. P. 13295-13306.

184. Rufener L., Keiser J., Kaminsky R., Maser P., Nilsson D. Phylogenomics of ligand-gated ion channels predicts monepantel effect // PLoS pathogens. 2010. V. 6. № 9. P. el001091

185. Saito M. Molecular dynamics simulation of proteins in solution: artifacts caused by the cut-off approximation // Journal of chemical physics. 1994. V. 101. P. 4055-5061.

186. Sanbonmatsu K.Y., Tung C.S.High performance computing in biology: multimillion atom simulations of nanoscale systems // Journal of structural biology. 2007. V. 157. № 3. P. 470-480.

187. Sanguinetti M.C., Xu Q.P. Mutations of the S4-S5 linker alter activation properties of HERG potassium channels expressed in Xenopus oocytes // Journal of physiology. 1999. V. 514. P. 667-675.

188. Santoro B., Liu D.T., Yao H., Bartsch D., Kandel E.R., Siegelbaum S.A., Tibbs G.R. Identification of a gene encoding a hyperpolarization-activated pacemaker channel of brain // Cell. 1998. V. 93. № 5. P. 717-729.

189. Schmid R., Miah A.M., Sapunov V.N. A new table of the thermodynamic quantities of ionic hydration: values and some applications (enthalpy-entropy compensation and Born radii) // Physical chemistry chemical physics. 2000. V. 2. P. 97-102.

190. Scholle A., Zimmer T., Koopman R., Engeland B., Pongs O., Benndorf K. Efects of Kvl.2 intracellular regions on activation of Kv2.1 channels // Biophysical journal. 2004. V. 87. № 2. P. 873-882.

191. Schreiter C., Hovius R., Costioli M., Pick H„ Kellenberger S„ Schild L., Vogel H. Characterization of the ligand-binding site of the serotonin 5-HT3 receptor // the role of glutamate residues 97, 224, AND 235 // Journal of biological chemistry. 2003. V. 278. № 25. P. 22709-22716.

192. Schuhmacher A., Mossner R., Quednow B.B., Kuhn K.U., Wagner M., Cvetanovska G., Rujescu D., Zill P., Moller H.J., Rietschel M., Franke P., Wolwer W., Gaebel W., Maier W. Influence of 5-HT3 receptor subunit genes HTR3A, HTR3B, HTR3C, HTR3D and HTR3E on treatment response to antipsychotics in schizophrenia // Pharmacogenetics and genomics. 2009. V. 19. № 11. P. 843-851.

193.Schultz J.H., Volk T., Ehmke H. Heterogeneity of Kv2.1 mRNA expression and delayed rectifier current in single isolated myocytes from rat left ventricle // Circulation research. 2001. V. 88. № 5. P. 483-490.

194. Schwede T„ Kopp J., Guex N., Peitsch M.C. SWISS-MODEL: an automated protein homology-modeling server // Nucleic acids research. 2003. V. 31. № 13. P. 3381-3385.

195. Sharman J.L., Benson H.E., Pawson A.J., Lukito V., Mpamhanga C.P., Bombail V., Davenport A.P., Peters J.A., Spedding M., Harmar A.J. IUPHAR-DB: updated database content and new features // Nucleic acids research. 2013. V. 41. № D1. P. D1083-D1088.

196. Shaytan A.K., Ivanov V.A., Shaitan K.V., Khokhlov A.R. Free energy profiles of amino acid side chain analogs near water-vapor interface obtained via MD simulations // Journal of computational chemistry. 2010. V. 31. № 1. P. 204-216.

197. Shindyalov I.N., Bourne P.E. Protein structure alignment by incremental combinatorial extension (CE) of the optimal path // Protein engineering. 1998. V. 11. № 9. P. 739-747.

198. Sine S.M., Engel A.G. Recent advances in Cys-loop receptor structure and function // Nature. 2006.V. 440. № 7083. P. 448-455.

199. Smart O.S., Neduvelil J.G., Wang X., Wallace B.A., Sansom M.S. HOLE: a program for the analysis of the pore dimensions of ion channel structural models // Journal of molecular graphics. 1996. V. 14. № 6. P. 354-60, 376.

200. Smit A.B., Syed N.I., Schaap D., van Minnen J., Klumperman J., Kits K.S., Lodder H., van der Schors R.C., van Elk R., Sorgedrager B., Brejc K., Sixma T.K., Geraerts W.P. A glia-derived acetylcholine-binding protein that modulates synaptic transmission // Nature. 2001. V. 411. № 6835. P. 261-268.

201. Sokolova O., Kolmakova-Partensky L., Grigorieff N. Three-dimensional structure of a voltage-gated potassium channel at 2.5 nm resolution // Structure. 2001. V. 9. JVb 3. P. 215-220.

202. Sokolova O., Accardi A., Gutierrez D., Lau A., Rigney M., Grigorieff N. Conformational changes in the C terminus of Shaker K+ channel bound to the rat Kvbeta2-subunit // Proceedings of the national academy of sciences of United States of America. 2003. V. 100. № 22. P. 1260712612.

203. Spier A.D., Lummis S.C.The role of tryptophan residues in the 5-Hydroxytryptamine(3) receptor ligand binding domain. // Journal of biological chemistry. 2000. V. 275. № 8. P. 56205625.

204. Stevens L., Ju M., Wray D. Roles of surface residues of intracellular domains of heag potassium channels // European biophysics journal. 2009.V. 38. Jte 4. P. 523-532.

205. Tai K., Haider S., Grottesi A., Sansom M.S. Ion channel gates: comparative analysis of energy barriers // European biophysics journal. 2009. V. 38. № 4. P. 347-354.

206. Taly A., Delarue M., Grutter T., Nilges M., Nov"ere N.L., Corringer P., Changeux J. Normal mode analysis suggests aquaternary twist model for the nicotinic receptor gating mechanism // Biophysical journal. 2005. V. 88. P. 3954-3965.

207. Taly A., Corringer P.J., Guedin D., Lestage P., Changeux J.P. Nicotinic receptors: allosteric transitions and therapeutic targets in the nervous system // Nature reviews. Drug discovery. 2009. V. 8. № 9. P. 733-750.

208. Tao X., Avalos J.L., Chen J., MacKinnon R. Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution // Science. 2009. V. 326. № 5960. P. 1668-1674.

209. Tasneem A., Iyer L.M., Jakobsson E., Aravind L. Identification of the prokaryotic ligand-gated. ion channels and their implications for the mechanisms and origins of animal Cys-loop ion channels // Genome biology. 2005. V. 6. № 1. P. R4.

210. Terlau H., Heinemann S.H., Stuhmer W., Pongs O., Ludwig J. Amino terminal-dependent gating of the potassium channel rat eag is compensated by a mutation in the S4 segment // Journal of physiology. 1997. V. 502. P. 537-543.

211. Terstappen G.C., Reggiani A. In silico research in drug discovery // Trends in pharmacological sciences. 2001. V. 22. № 1. P. 23-26.

212. Thomas M., Jayatilaka D., Corry B. How does overcoordination create ion selectivity? // Biophysical chemistry. 2013. V. 172. P. 37-42.

213. Thompson A.J., Price K.L., Reeves D.C., Chan S.L., Chau P.L., Lummis S.C. Locating an antagonist in the 5-HT3 receptor binding site using modeling and radioligand binding // Journal of biological chemistry. 2005. V. 280. № 21. P. 20476-20482.

214. Thompson A.J., Lummis S.C.R. The 5-HT3 receptor as a therapeutic target. Expert opinion in therapeutic targets. 2007. V. 11. № 4. P. 527-540.

215. Thompson A.J., Lester H.A., Lummis S.C. The structural basis of function in Cys-loop receptors // Quarterly reviews of biophisics. 2010. V. 43. № 4. P. 449-499

216. Tieleman D.P., Biggin P.C., Smith G.R., Sansom M.S. Simulation approaches to ion channel structure-function relationships // Quarterly reviews of biophisics. 2001. V. 34. № 4. P. 473-561.

217. Tombola F., Pathak M.M., Isacoff E.Y. How Does Voltage Open an Ion Channel? // Annual reviews of cell and developmental biology. 2006. V. 22. P. 23-52.

218. Topf M., Sali A. Combining electron microscopy and comparative protein structure modeling // Current opinion in structural biology. 2005. V. 15. № 5. P. 578-585.

219. Trabuco L.G., Villa E., Mitra K., Frank J., Schulten K. Flexible fitting of atomic structures into electron microscopy maps using molecular dynamics // Structure. 2008. V. 16. JSfe 5. P. 673-683.

220. Treptow W., Tarek M. K+ conduction in the selectivity filter of potassium channels is monitored by the charge distribution along their sequence // Biophysical journal. 2006. V. 91. № 10. P. L81-83.

221.Tsuk S., Michaelevski I., Bentley G.N., Joho R.H., Chikvashvili D., Lotan I. Kv2.1 channel activation and inactivation is influenced by physical interactions of both syntaxin 1A and the syntaxin 1 A/soluble N-ethylmaleimide-sensitive factor-25 (t-SNARE) complex with the C terminus of the channel // Molecular pharmacology. 2005. V. 67. № 2. P. 480-488.

222. Ujwal R., Cascio D., Colletier J.P., Faham S., Zhang J., Toro L., Ping P., Abramson J. The crystal structure of mouse VDAC1 at 2.3 A resolution reveals mechanistic insights into metabolite gating // Proceedings of the national academy of sciences of United States of America. 2008. V. 105. № 46. P. 17742-17747.

223. Unwin N. Refined structure of the nicotinic acetylcholine receptor at 4A resolution // Journal of molecular biology. 2005. V. 346. № 4. P. 967-989.

224. Unwin N., Fujiyoshi Y. Gating movement of acetylcholine receptor caught by plunge-freezing // Journal of molecular biology. 2012. V. 422. № 5. P. 617-634.

225. Uysal S., Vasquez V., Tereshko V., Esaki K., Fellouse F.A., Sidhu S.S., Koide S., Perozo E., Kossiakoff A., Crystal structure of full-length KcsA in its closed conformation // Proceedings of the National Academy of Sciences of United States of America. 2009. V. 106. № 16. P. 66446649.

226. VanDongen A.M., Freeh G.C., Drewe J.A., Joho R.H., Brown A.M. Alteration and restoration of K+ channel function by deletions at the N- and C-termini // Neuron. 1990. V. 5. № 4. P. 433443.

227. Verlet L. Computer "experiments" on classical fluids. I.thermodynamical properties of lennard-jones molecules // Physical review. 1967. V. 159. P. 98-103.

228. Wadhwa S., Wadhwa P., Dinda A.K., Gupta N.P. Differential expression of potassium ion channels in human renal cell carcinoma // International urology and nephrology. 2009. V. 41. № 2. P. 251-257.

229. Wareing M., Bai X., Seghier F„ Turner C.M., Greenwood S.L., Baker P.N., Taggart M.J., Fyfe G.K. Expression and function of potassium channels in the human placental vasculature // American journal of physiology. Regulatory, integrative and comparative physiology. 2006. V. 291. №2. P. 437-446.

230. Weill C.L., McNamee M.G., Karlin A. Affinity-labeling of purified acetylcholine receptor from Torpedo californica // Biochemical and biophysical research communications. 1974. V. 61. № 3. P. 997-1003.

231. Wickenden A., Priest B., Erdemli G. Ion channel drug discovery: challenges and future directions. Future medicinal chemistry. 2012. V. 4. № 5. P. 661-679.

232. Wilson G., Karlin A. Acetylcholine receptor channel structure in the resting, open, and desensitized states probed with the substituted-cysteine-accessibility method // Proceedings of the National Academy of Sciences. 2001. V. 98. № 3. P. 1241-1248.

233. Wray D. Intracellular regions of potassium channels: Kv2.1 and heag // European biophisics journal. 2009. V. 38. № 3. P. 285-292.

234. Xu C., Lu Y., Tang G., Wang R. Expression of voltage-dependent K(+) channel genes in mesenteric artery smooth muscle cells // American journal of physiology. 1999. V. 277. P. 10551063.

235. Yarov-Yarovoy V., Baker D., Catterall W.A. Voltage sensor conformations in the open and closed states in ROSETTA structural models of K(+) channels // Proceedings of the National Academy of Sciences of United States of America. 2006. V. 103. № 19. P. 7292-7297.

236. Ye S., Li Y., Chen L., Jiang Y. Crystal structures of a ligand-free MthK gating ring: insights into the ligand gating mechanism of K+ channels // Cell. 2006. V. 126. № 6. P. 1161-1173.

237. Yellen G. The voltage-gated potassium channels and their relatives // Nature 2002. V. 419. № 6902. P. 35-42.

238. Yu F.H., Catterall W.A. The VGL-chanome: a protein superfamily specialized for electrical signaling and ionic homeostasis // Science's STKE. 2004 . № 253. P. rel5.

239. Yu F.H., Catterall W.A. The VGL-chanome: a protein superfamily specialized for electrical signaling and ionic homeostasis // Science's STKE. 2004. V. 2004. № 253. P. rel5.

240. Zagotta W.N., Hoshi T., Aldrich R.W. Shaker potassium channel gating. Ill: evaluation of kinetic models for activation // Journal of general physiology. 1994. V. 103. № 2. P. 321-362.

241. Zagotta W.N., Olivier N.B., Black K.D., Young E.C., Olson R., Gouaux E. Structural basis for modulation and agonist specificity of HCN pacemaker channels // Nature. 2003. V. 425. № 6954. P. 200-205.

242. Zhou Y., Morais-Cabral J.H., Kaufman A., MacKinnon R. Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0A resolution // Nature. 2001. V. 414. № 6859. P. 43-48.

243. Zhu F., Hummer G. Pore opening and closing of a pentameric ligand-gated ion channel // Proceedings of the National Academy of Sciences. 2010. V. 107. № 46. P. 19814-19819.

Приложение 1. Выравнивание трансмембранного домена аминокислотной

последовательности канала Kv2.1 по шаблону КлТ.2 (А). Выравнивание

трансмембранного домена аминокислотной последовательности канала Kvl0.2 по

шаблону MloKI (Б). Выравнивание аминокислотной последовательности С-концевого

домена cNBD канала Kvl0.2 по шаблону бактериального сАМР-зависимого канала MloKI

(В). Выравнивание аминокислотной последовательности N-концевого домена PAS-PAC

канала Kvl0.2 по шаблону N-концевых доменов калиевого канала человека herg (Г).

Выравнивание аминокислотной последовательности 5-НТЗ рецептора по шаблону

ацетилхолинового рецептора nAchR (Д). Серым выделены петли и спирали.

si

KV12 ARIIAIVSWVILIÎIVSFC LETLP IFPDQmXiaMGVTri^^NST ICVQ

AKV2.1 A^UIKIHrJVLSTIALSLNTLPELaSlIJE-----------------FG

*-**♦ *■♦*■■ * * ** * *

S2 S3

KV1 .2 QSTSrTCÏ FTrTtTLCII^TErETLTOJT.V;pS:'AGîTTOI!.!BTIDIVM IP

KV2 .1 QSTDNP -Q1AHVIAVCIA'..TTUKLLRFLSSП-3-Г,,T~KCP LKAIDLiAI LP * * * ** ****--*.*■** * * ** *** ***

S4

KV1.2 yriTUTIELAZKPEEACKKQCÏO.E LAI UTVIKLVWTRIFiCLSHHSKGLQIL

KV2.1 YWTIF- - LTESH>SYLQFQ(T/?! " .^IFr-JI-tW: LRILKIAMSSTCLQSL

* * * * ** * * ** ** *** *** *

S5

KV1 .2 GOT LKASIFBLGLIJFF LFIG/IIJF SSAVYFAEAEERDgQFPS IPDAFVA-.AV

KV2 1 СГГ LF'PSYl*UXLI LT LMJGïmFSS WFTAEKEEOD'H.TKS I PAS ПЛАТ

* ** * ****** * * ■ * *** * *** ** * - ♦ *** * ** »

SF S6

KVI .2 vaiTT/iyœr.>TTiix:KivcsiXAiA£r^TiAi^^T\avSKnriTra-ET

KV2 .1 1JTTVCKGDI YPKT LLCMP^ÎGLCCIА£ГЛ.УХЛ Li> XP ЫУШГЗЕГГгЕСК

******** * ♦ ***** ** ***** **** * * ** **

S1 S2

MloKI lh IAA gll a -l I DM G .la ll V wga L----L A

kvl0.2 dw iil fît m py v fk к awl d V twi I.vdivi. h

Б

S3

MloKI at KRR GV RDRTPK---------- ID b vlvp-- AAFLLD pd

1^10.2 TT GPG EV SD--PKLIRMNYLKTW С PYDI N ENV GI

:*:: . *: * ** :.**:*:* : ** S4 S5

lCLoKI WSL W P dst FPV ViAMERNL G T LA LAA Kvl0.2 SSL К L .RLGR ARKL YLEYGAAVLL С f G VA Vf ACIW **:.:: ::: ** . . *.: * * :. :**:* .

MloKI ЛЯЕ-R ------------------------------------QP R'F S

KV10.2 l'SIGDï IDEVTNTIQIDSWLYQLALSIGTPYRYHTSAGIWEGGP KD L

* * :i SF S6

moia f g g v s ig lwa--il

kvlo . 2 ^misimeylss1^ t d e v m v sl tif nvtt

.::::::.:*:* *:*: * : . :::: *:** * ::. *

2KXL IFQKLGFAVLVEIVRAIRARTVPAGAVICRIGEPGDRMFF/VEGSV'SVAT clIBD AFRLÄSDGCLRALAVEFQTIHCÄEGDLIYHAGESVDALCFv^SGSLEVIQ *: * ::: ..* :* : **. * : ***_*+;_*

2 KXL PNFV- -ELGPGAFFGEKALI SGEFRSATVSAATTVSLLSLHSADFQM1CS

CÏÏ3D DDEWAILGKGDVFGDI FÄKETTL------AHACAl'ÏVRALTYCDLHIIKR

: * ** * .**;: . * ; ..: :* .*::::

2 KXL SS-PEIAEIFRKTALERRGAAASA CNBD EALLKVLDFYTAFANSFSRNLTLT

2L0KA GH :QîîT DT EGQSRHFI IANARTENGV IYOTOG CE

PAS-EAC ----------QUI. I ENI.. SS—ESS Л. LGKAQIVDisï'iVTiSKDGïC.-.

*****. . . .*::.**:: : .*:*.*****:

2L0WA lCGYSr"E'-'Q FCTCDFLHGFRTQRRAAAQIAÇALL6ÂEEFKVEIAFYR PAS-PAC LSGYHKADVXQáSSTCSRíYGELTDKKTIEK'v'RQTFDNYESKCíEíXLY-.

**.*+*;__**_+;;* *:::: :: *:: . *.. .*: :*:

2L0WA KDGSCFIG "Л)Т.~ЛГ "XNEDGAv T' 'TT LNFEV7M---------EK

РАЗ-РАС <чК т ...Y..Q ÍUHEHEI-.TVLÍ LCT:::DITL:-KQPIEDDSI

d

5 -HT3R_A ? LSC-/L LTWt^G'^^^rn^TTTVSimrrWAl ШЯЕгаДОЦИКН?

AchR_« ? L'.'AN L LENY1-T ГУХ?. P.'EHHTHr.'CIT.'GLQLIQL INvTEvTIQr ."ETW/R

♦ * ■* ** * *** ♦ ** ★

A

5-HT3R_A ykjyvnmflq шрепгшi tk ls ip TOS IWVPDI limefvovck' spni

AchR_ci иО&ПВЛ<и ."n^adycjgi i-kxrxp SDITAf lpdlv ijsieadgef aivhl' *"* * * ■*•**•** » * - * * *** *

Е _В_

5-HT3R_A f1vyi KHSdT^JKYKPLQ/VTACS ldiynff fdvqhgs LT FT svftjtt IQD AchR_ct TKLLLXTSÍTG"imv/tf faif KSYCE iivthff JDQÛNCTÎ CCLGIWTiDCTK

* * * - ** Hr* * * * *

_ _r_____С

5-ht3r_a imslwlüj*kvk»l«5vnaoarv«u.gv- lpytketsmtssmvyaeu

AdiR_a VSIS- Î^SDFPDLSTTyiSC»f^M3\ROrt®A^nPrîrPDrPîfUlI

** ** ♦ ♦ ♦ *• *

Ш _ _U2

5-HT3R_A ktywiRRRP LFYWSL LLP SI fua^MDIVGFYLPPHS GERVSFKITLL L AchR_a ТадГПКР IP LXTWlf/II PCL LT SF LTV LVTY LP tds Œ ШТ LS ISVL L

- - • ч» » * - - ** . . . fr ... ** *tr - * ** .... * . - * *

Ш

5-HT3R_A GYSVF LIIVSDT l fataigtplicvyiwqjal lviSLAE ti f ivrlvhk AchR_a S LTVF L u/ive li ps ts sa vp L ICKM-F tviitvi SSI ivtvwintisir

** * - * * • ** *» » - - * ... ♦ . * - # •

5-HT3R_A ODLQQPVPAW IRH LVLERIAWL 1С LÄIDS TSCUPPATSQATK - -TDDCSA

AchR_« SPSTîmffÇKVRKIT intipnvîjff---s 1mmras kekœhkifaddidi

* * * **

IIA

5 -ht3R_a mqiacsaiogpadnacs prdrcsf pf pfreas lavcgl îgri s siíofli

AchR_<x sdi sgkq/tgkf IFQT-----------PLIKNFDVKSAIICVKYIADMK

* * * ♦ - *

114

5-HT3R_A ; - ЛЕТ RKVAMJW LíVGSVLD, 0. LT HI YL LAV IAYSITLV- MLWSIWQÏ'A AchR a SIEKSSNAAHOíKWíJí/IDHI LLCVFViLICIICT/SVTACRLIELSCEG

Приложение 2. Протокол МД расчетов. Протокол МД расчетов для системы моделей канала Kv2.1, встроенных в мембрану в открытой и закрытой конформации (А). Протокол МД расчетов для системы пентамерного канала 5-НТЗ рецептора с лигандом (Б). Протокол УМД. Системы пентамерного канала 5-НТЗ рецептора и тетрамерного канала Kv2.1 с ионом калия в поре (В). Протокол МД. Расчет потенциала средней силы для канала Kv2.1 и серотонинового 5-НТЗ рецептора (Г).

А «Программный пакет N AMD

• Потенциальное поле CHARMM22 •Длина траектории 40 не, 68 не •Динамика Ланжевена

• Температура термостата 300К •Анизотропный баростата.

• Давление баростата 1 бар

• радиус обрезания в прямом пространстве 8 А.

• Радиус обрезания ван-дер-ваальсовых взаимодейстий - 8 А. •Шаг интегрирования 2 фс

• Шаг записи в траекторный файл 5000

•Для численного интегрирования использовался алгоритм Leap-Frog. •Метод учета электростатических взаимодействий РМЕ •Диэлектрическая проницаемость среды 1

• Использовалась кубическая периодическая ячейка размером 150X150X100 А3 •Для численного интегрирования использовался алгоритм Leap-frog.

• Начальные скорости задавались в соответствии с распределением Максвелла с помощью генератора случайных чисел.

Г

-"Релаксацию системы проводили без учета электростатических взаимодействий (для этого диэлектрическая постоянная среды была увеличена до 100), в режиме «мягкие ядра» (в

(в котором потенциал Леннард-Джонса аппроксимируется параболой в области высоких значений энергий) и с уменьшенным шагом интегрирования (0,0002 фс).

• Пакет молекулярной динамики: Gromacs

• Потенциальное поле: OPLS-AA •Длина траектории: 4 не

• Температура термостата: 300К

• Термостат: стохастическая динамика

• Постоянная термостатирования т = 0,2 пс

• Баростат - Берендсена

• Радиус обрезания для кулоновских взаимодействий Rel =20

• Радиус обрезания для сил Ван-дер-Ваальса RVdW =20

• Для численного интегрирования использовался алгоритм Leap-frog.

• Шаг интегрирования 1 фс.

• Шаг записи с траекторный файл 1 пс.

• Начальные скорости определялись с помощью генератора случайных чисел по распределению Максвелла.

J • Пакет молекулярной динамики Gromacs

• Потенциальное поле: OPLS-AA

• Длина траектории: 2 не

• Температура термостата: 300 К

• Используемые термостаты: стохастическая динамика.

• Постоянная термостатирования: т=0.2 пс

• Радиус обрезания для кулоновских взаимодействий Rel =20

• Радиус обрезания для сил Ван-дер-Ваальса RVdW =20

• Шаг интегрирования: dt=l фс

• Тип воды spc

• Внешнее ускорение К+ а=5 нм/пс2 для Kv2.1, К+ 4,8 нм/пс2 для 5-НТЗ рецептора

• Использовалась управляемая молекулярная динамика, к ионам К+ прикладывалось внешнее ускорение вдоль оси канала

—*

• Пакет молекулярной динамики Gromacs

• Потенциальное поле: OPLS-AA

•Длина траектории: 1 не

• Температура термостата: 300 К

•Используемые термостаты: стохастическая динамика.

• Баростат - Берендсена

• Постоянная баростатирования — 10 пс

• Давление баростата вдоль нормали мембраны: 1 бар

• Постоянная термостатирования: т=0.2 пс

• Радиус обрезания для кулоновских взаимодействий Rel =20

• Радиус обрезания для сил Ван-дер-Ваальса RVdW =20

• Шаг интегрирования: dt=l фс

• Тип воды spc

• Для численного интегрирования использовался алгоритм Leap-frog.

• Шаг интегрирования 1 фс.

• Шаг записи с траекторный файл 1 пс.

• Начальные скорости определялись с помощью генератора случайных чисел по распределению Максвелла.